SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028725 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028725
Domain Number 1 Region: 58-135
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000577
Family I set domains 0.019
Further Details:      
 
Domain Number 2 Region: 11-51
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000311
Family I set domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028725   Gene: ENSSSCG00000002893   Transcript: ENSSSCT00000033455
Sequence length 197
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:40383412:40385785:-1 gene:ENSSSCG00000002893 transcript:ENSSSCT00000033455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRKRNPLKESRDLRFEAITPEDAGSYHCLVNNSIGQTTSQAWELRVLYAPRGLHVSISPK
DGVVEGKTAVLSCEGDANPPIFQYTWFDWNNQDIHHYHQTLKLDPVTVQHSGAYWCQGVN
QLGRNHSPPSTLTVHYSAATISRRAAMGVGFFLAILLLAIWGVKLRQTWKRIRSQQGFQE
NSNGQSFFVRNIKVGQG
Download sequence
Identical sequences ENSSSCP00000028725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]