SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028880 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028880
Domain Number 1 Region: 86-220
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.66e-32
Family Toll/Interleukin receptor TIR domain 0.0000866
Further Details:      
 
Domain Number 2 Region: 28-89
Classification Level Classification E-value
Superfamily L domain-like 0.000000000374
Family Ngr ectodomain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028880   Gene: ENSSSCG00000005503   Transcript: ENSSSCT00000035900
Sequence length 245
Comment pep:novel chromosome:Sscrofa10.2:1:289775822:289785847:1 gene:ENSSSCG00000005503 transcript:ENSSSCT00000035900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPRIRLAVATIPAMAFLSCLRSESWDPCVQVVPNISYQCMELNFYKIPDNIPTSVKILD
LSFNYLSHLDSNSFSSFPELQVLDLSSQDEDWVRNELVKNLEEGVPPFHLCLHYRDFIPG
VAIAANIIQEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLRSHAGIIFIVLQKLE
KSLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLKKALLDGKPWSPEGTEDSESNQHD
TTAFT
Download sequence
Identical sequences ENSSSCP00000028880 NP_001280246.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]