SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028944 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028944
Domain Number 1 Region: 15-108
Classification Level Classification E-value
Superfamily Globin-like 1.94e-32
Family Globins 0.00000585
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028944   Gene: ENSSSCG00000007978   Transcript: ENSSSCT00000034348
Sequence length 108
Comment pep:novel chromosome:Sscrofa10.2:3:40950792:40951542:1 gene:ENSSSCG00000007978 transcript:ENSSSCT00000034348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVGGQAGAHGAEALESHGSDQVKAHGQKVADALTKAVGHLDDLPGALSALSDLHAHKLRV
DPVNFKLLSHCLLVTLAAHHPDDFNPSVHASLDKFLANVSTVLTSKYR
Download sequence
Identical sequences ENSSSCP00000028944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]