SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029000 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029000
Domain Number 1 Region: 15-164
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-48
Family Protein kinases, catalytic subunit 0.00000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029000   Gene: ENSSSCG00000012773   Transcript: ENSSSCT00000035205
Sequence length 168
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:141991089:141992682:-1 gene:ENSSSCG00000012773 transcript:ENSSSCT00000035205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLKKQTEDISSVYEIREKLGSGAFSEVVLAQERGSSHLVALKCIPKKALRGKEALVEN
EIAVLRRVSHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQV
LGAVSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNM
Download sequence
Identical sequences ENSSSCP00000029000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]