SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029218 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029218
Domain Number 1 Region: 32-102
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000683
Family BRCT domain 0.041
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000029218
Domain Number - Region: 6-43
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00783
Family FHA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029218   Gene: ENSSSCG00000006127   Transcript: ENSSSCT00000035696
Sequence length 134
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:51264196:51275678:1 gene:ENSSSCG00000006127 transcript:ENSSSCT00000035696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTDFSQTLKTGDRVTFGVFKSKFRVEYEPLVACSSCLDVSGKTALSQTILQLGGLTMNN
WTEECTHLVMVSVKVTIKTICALICGRPIVKPEYFTEFLKAVQSKKHPPEIERFYPPVDE
PAIVSKNIDLSGRQ
Download sequence
Identical sequences ENSSSCP00000029218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]