SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029367 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000029367
Domain Number - Region: 74-130
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 0.0348
Family Interleukin 8-like chemokines 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029367   Gene: ENSSSCG00000017920   Transcript: ENSSSCT00000035152
Sequence length 286
Comment pep:novel chromosome:Sscrofa10.2:12:54264906:54269592:1 gene:ENSSSCG00000017920 transcript:ENSSSCT00000035152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRRSGRRKRKLLRKQLDARLPSSSGCQPGRGRREKMPLWELWFFLLALFLAWLTPPGNG
NEGSMAGSCPCNRRISSHSPPTDHDMRHLRKYLNHYQHCTSYVRFQLPRGSVCGGSSDQW
VLKLMGCFDRGECGRAHARTVAHQQHLAPQNTRVPELPERAPPDSSTPAQTNLPSTLQPT
QKPTLPEGMPSLAKKLIPTSETDTSTVGHSLGAKSEARENQEQLGKNVGATAGTSALVPV
LSLLVIIFLLTGVLLYVMCKKRQEQSRQYPPDPQLHYVPVASNINT
Download sequence
Identical sequences K7GPV8
ENSSSCP00000029367 9823.ENSSSCP00000018985 XP_005669231.2.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]