SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029389 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029389
Domain Number 1 Region: 1823-1927
Classification Level Classification E-value
Superfamily BRCT domain 1.24e-20
Family 53BP1 0.072
Further Details:      
 
Domain Number 2 Region: 28-137
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000000542
Family FHA domain 0.002
Further Details:      
 
Domain Number 3 Region: 1934-2014
Classification Level Classification E-value
Superfamily BRCT domain 0.0000189
Family BRCT domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029389   Gene: ENSSSCG00000001362   Transcript: ENSSSCT00000035889
Sequence length 2029
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:26951468:26965463:-1 gene:ENSSSCG00000001362 transcript:ENSSSCT00000035889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDTQVINWEAEEEEVEEGPSEPLGCNLQPVGQLRIFSSSYGPEKDFPLYLGKNVVGRMP
ECSVALPFSSISKQHAVIEILAWNKAPVLRDCGSLNGTQILRPPKVLGPGVSHRLRNREL
ILFADLPCQYHRLDVPPPLVSRGPLTVEETPRGQGGTQPHRLLLAEDSEEEVDSLSERCV
VKGPKTSLTTVIPESDEEGPSPAPDGPGPPFAFNLNSDTDEEESQQPGAGEAPSAAETEQ
PKPVTTEIQLIKDQCPVKEKHKDARVKRAASNGVVPVGAILERSQPAGEDSDTDVDEGSG
LPRRPAGAHSERAQPCGFIDSDTDAEEEGIPATPAVVPVKKRQIFHEVGTESPQAPGVAH
AQESPAGSDTDIEEGEAPRTVPLDSSRASMMIDSNMDDEEEVSAALTLARLRESQAVPWN
RDAGAGDHRAQPVALLDQSQASAGRDSDTDMEEEGLPLEKRGSLPKGPADKAHPEKSQPP
LRGSDVKVEEDERSPGVHPGRSQASATVDAITQVEEKAPPRPAVTLSEKHQVPVAWTPQT
DVEAEGDPAKLPVVHPAEARPPPAGGHEPDVEKNTSLAASAGADVRKSQLLAEGDAGTEW
AVAILEQDRALGAGAQSVSARAQVGQDLPLVSREHLADVAVDTGAPGEATQTQREGTQAL
TERERELNVDRTIDSGDNRDDSEDLDLQATQCFVEGENQSPEAVPSMEDEPTQAFPSTLP
QEPGPSCCSFQASGTLDEPWELLATQPFCPRESEASEIQPVDTHLEARGLCPSPPRAALP
EQHPESPEPLGSQGGGRQTVEKATGTPRETAEGPTPERGPLERATKEPPSEGERGGMGEE
GLPRGTQDREEKQVLAGVTQRQESDRTVKSTSTDGGLESLQVEIETPKEMQENEIEKQTL
ARDMLEREAEKPVAERESEAGGPEVKVPEAVQDRGPLRAEAEGTSQDQKGQASNLTPEPG
AGVGYLQGLASAPAAPRSQAGGGGEAPVSPRRQQRGDLNCKMPPAEKSGGDQESPEACLP
PEPPEASAPLQNPLPSQSPKHPAPQSRLSPPPPPLEQSTPRTRPPQSQESPEPPFSSELD
PPNPEPKVRPQGSPPLSPIPLEAHPTSPTDQAGSPEPTSRAARGGTHRSFEVTPMSVVPT
ALELQSSTSADQPVVPKPTLRAPWGRTHRSSVKTPEPNIPTAPELQPSTPTDQPVAPEPL
SRATRGRTPRASVKTSEPVVPAAPEPQPSTPTDQPVVPKPTLRAPRGRTHRSSVKTPEPN
IPTAPELRPSTPTDQPVAPEPLSRATRGRTPRASVKSPEQNVPTAPEHPQPSTPTDQPVT
PKPTSRATRGRAHRSSVKTPAASEPLPSASTDQPITPKPTSRGRAHRSSAKTPELQPPTS
TGQPVTPRPTSQATRGRTHRSSIKTPEPVVPTDPEPQPSTPTDQPITPELTSAATRGRTR
RSTVKTPEPVVPTDPEPQPSTPTDQPITPKPTSWATRGQAHRSSVKTPEPHVPTDPKPQP
STPTDQPVTPKPTSRATRGRARKSSVKTPEPVVPTAAEPQPSASTDQPITPKPTSRGRAH
RSSAKTPELQPPTSTGQPVTPRPTSGATQGRTHRSSAKTSQAVEPTAPVLEPPSPIGQPV
TPKVIAEGGQNRILRSSRVGAVPGPTPPELQCPVPAEQPVPPEPIPRASCSRRPRATRKR
ESLTAHVGPDPCSAPPEPNSRSSRTQSLSTTPEPTLPQLPEAPAHAPQIPKVEAAGRPGF
TLEPQPKATQKRKRPLAPADSPPLPKRLQRGEVPPKTVILEEEENPTARPGREEDAVIPE
PGKRKRDQTEEEPRGVPSRSLRRTKPAQESTAPRVLFTGVVDARGERAVLALGGSLASSV
AEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGCFLPPDEYVVTDPEQEKNFG
FSLREALSRARERKLLEGYEIHVTPGVQPPPPQMGEIISCCGGTVLPSMPRSYKPQRVVI
TCSQDFPRCSVPFRLGLPVLSPEFLLTGVLKQEAKPEAFVLSTLEMASA
Download sequence
Identical sequences ENSSSCP00000029389 XP_005665786.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]