SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029426 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029426
Domain Number 1 Region: 601-714
Classification Level Classification E-value
Superfamily DEATH domain 1.09e-26
Family DEATH domain, DD 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029426   Gene: ENSSSCG00000010212   Transcript: ENSSSCT00000033748
Sequence length 1093
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:68392395:68508007:-1 gene:ENSSSCG00000010212 transcript:ENSSSCT00000033748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPQSEDAVTGDTDKYLGPQDLKELGDDSLPAEGYVGFSLGARSASLRSFSSDRSYTLN
RSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLV
SFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRL
VEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLTELLNG
MDEELDSPEELGKKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASF
PEGALTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPS
GEGASNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLA
DCHQVLETVGLATQLYRELICVPYMAKFVVFAKMNDPVESSLRCFCMTDDKVDKTLEQQE
NFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYAFKENRLPFSIKIRDTSQ
EPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKMEKTERRQTFASLALRKRYSYLTEP
GMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLK
KWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENSVFHDPVDG
HPSLQVELETPTGLHYPSPTPFQQDDYFSDISSIESPLRTPSRLSDGVVPSQGDVEHSAD
GPPVVTAEDTSLEDSKLEDSMPLTEIPEAVAVDESQSENVYLSEYPQYLGSMPRVPKAVK
PAEALKQTRKVGVHSEQQEKGKSGPDEEMTEEKLRSLFEDIQLEEGVDSEEVTEEKVQAI
LKHVQQAELEMSSITGWQNETSSGNLEPPAQARRITGGLLDRLDDSPDQCRDSITSYLKG
EPGKFEANGSHAEVTPEAKTKSYFPESQNDVGKQSAKETLKPKIPGPGRVDEPSSSLAAY
QKALEETSKFVIEEPKPCMPVSMKKMSRTSPTDGKPRLNLHEEEGSNGSEQKGEGYKVKT
KKEIRHVEKKSHS
Download sequence
Identical sequences ENSSSCP00000029426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]