SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029443 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029443
Domain Number 1 Region: 3-38
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000397
Family Nuclear receptor 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029443   Gene: ENSSSCG00000025777   Transcript: ENSSSCT00000035668
Sequence length 39
Comment pep:known chromosome:Sscrofa10.2:1:16779138:16779254:-1 gene:ENSSSCG00000025777 transcript:ENSSSCT00000035668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKG
Download sequence
Identical sequences ENSSSCP00000029443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]