SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029536 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029536
Domain Number 1 Region: 19-98
Classification Level Classification E-value
Superfamily Lysozyme-like 3.75e-35
Family C-type lysozyme 0.0000346
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029536   Gene: ENSSSCG00000000492   Transcript: ENSSSCT00000033585
Sequence length 136
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:36179606:36185545:-1 gene:ENSSSCG00000000492 transcript:ENSSSCT00000033585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLLVLALLLLSVSVQAKVYDRCEFARILKKSGMDGYRGVSLANWVCLAKWESDFNTKA
INHNVGSTDYGIFQINSRYWCNDGKTPKAVNACHISCKGWHGELIVRTKMSRSTFGVANC
NCAVFLLQLTLSLFHI
Download sequence
Identical sequences ENSSSCP00000029536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]