SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029670 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029670
Domain Number 1 Region: 474-604
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.65e-54
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000239
Further Details:      
 
Domain Number 2 Region: 121-344
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.46e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000383
Further Details:      
 
Domain Number 3 Region: 295-471
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.4e-21
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029670   Gene: ENSSSCG00000012657   Transcript: ENSSSCT00000035301
Sequence length 609
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:122445048:122476744:-1 gene:ENSSSCG00000012657 transcript:ENSSSCT00000035301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRCGGLAAGALKQKLAPLVRTVCVRGPRQRNRLPVVQCHHLGSPSRSLASTGASGKDGS
SLVYFLIVGATVTGAGVYYAYRTIKDNKKRYNERIAGLGLTPEEKQKRATSSAPEGEPVP
QVRVPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDD
PNVTKTLRFRQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRGNMAK
LNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRTLEKISREVKSIT
IIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVL
PNAIVQSVGVSGGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVN
AELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWS
DLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEAPEITLP
VGSPAVPQAPTQGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEV
AKLFNIHED
Download sequence
Identical sequences XP_020935134.1.46622 ENSSSCP00000029670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]