SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029810 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029810
Domain Number 1 Region: 70-324
Classification Level Classification E-value
Superfamily Translation proteins 1.31e-73
Family Ribosomal protein L3 0.0000768
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029810   Gene: ENSSSCG00000011179   Transcript: ENSSSCT00000035743
Sequence length 348
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:763902:803026:1 gene:ENSSSCG00000011179 transcript:ENSSSCT00000035743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGWGLLGRAGARVLGCGADGLGASRGLGNRTDICLLVRSLHGKSVTWWDEHLSEENVPF
VKQLVSDENKAQLASKLCPLKDEPWPIHPWEPGSSRVGLIALKLGMMPLWTKDGQKHVVT
LLQVQDCHVLKYTPKENHNGRMAALTVGGKTVSHFHKSASILEFYQELGLPPKQKVKIFN
VTENAVIKPGTPLYAAHFRPGQYVDVTAKTIGKGFQGVMRRWGFKGQPATHGQTKTHRRP
GAISTGDVARVWPGTKMPGQLGNIDRTAFGLKVWRINTKHNIIYVNGSVPGHKNCLVKIK
DSKLPAYKDFCKNLPFPTYFPDGDEEALPEDLYDENVCQPGAPSITFT
Download sequence
Identical sequences ENSSSCP00000029810 4v19_E 5aj4_BE 6gaw_BE 6gb2_BE 9823.ENSSSCP00000011927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]