SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029828 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029828
Domain Number 1 Region: 19-45
Classification Level Classification E-value
Superfamily Lysozyme-like 0.0000493
Family C-type lysozyme 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029828   Gene: ENSSSCG00000000492   Transcript: ENSSSCT00000034939
Sequence length 77
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:36179466:36185516:-1 gene:ENSSSCG00000000492 transcript:ENSSSCT00000034939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLLVLALLLLSVSVQAKVYDRCEFARILKKSGMDGYRGVSLANSATGVMMARHPKQLM
PVTYPAKFCWTMTSVKI
Download sequence
Identical sequences ENSSSCP00000029828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]