SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029919 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029919
Domain Number 1 Region: 42-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.49e-36
Family SCAN domain 0.0000805
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029919   Gene: ENSSSCG00000012689   Transcript: ENSSSCT00000033388
Sequence length 123
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:126803527:126806596:1 gene:ENSSSCG00000012689 transcript:ENSSSCT00000033388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMRHLKVNACLYPHMEALWETKGSVKESCSQSKQSSPQMDSLGPESARQHFRSFYYHEA
PGPLEAVSQLQELCHQWLRPEIHSKEQILELLVLEQFLTILPRDTQNWVQKYHPQSIKEA
VAL
Download sequence
Identical sequences ENSSSCP00000029919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]