SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029996 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029996
Domain Number 1 Region: 33-140
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.83e-26
Family Rhodopsin-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029996   Gene: ENSSSCG00000012600   Transcript: ENSSSCT00000032975
Sequence length 140
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:109824789:109826748:-1 gene:ENSSSCG00000012600 transcript:ENSSSCT00000032975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDNFTLVTISKNITSSLHVGLVNISGNESTFNCSHKPSDKHLDAIPILYYIIFVVGFLV
NTIVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFG
SFLTLNMFASIFFITCMSVD
Download sequence
Identical sequences ENSSSCP00000029996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]