SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029997 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029997
Domain Number 1 Region: 155-455
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.17e-57
Family Protein kinases, catalytic subunit 0.00044
Further Details:      
 
Domain Number 2 Region: 9-122
Classification Level Classification E-value
Superfamily DEATH domain 2.62e-29
Family DEATH domain, DD 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029997   Gene: ENSSSCG00000000475   Transcript: ENSSSCT00000035165
Sequence length 614
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:33800191:33872499:1 gene:ENSSSCG00000000475 transcript:ENSSSCT00000035165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWTAAGSGGARGALSAHTLLFDMPPTLLGEFCAVLDSCDGALGWRGLAERLSSSWLDVR
HIEKYVDQGKSGTRELLWSWAQKNKTIGDLLQVLQEMGHHRAIHLIANYGAALNPSEWNH
QGKRFPNVLSKEIANVTVANAPIPERNEKGILLKSSISFQNIIEGTKNFHQDFLIGEGEI
FEVYRVEIQNRTYAIKLFKQEKKMQCKKQWKSFLSELEVLLLVHHPNILELVAYFTKSEK
FCLVYPYMRNGSLFDRLQCVDNTAPLSWHVRISVLIGTAKAIQYLHSREPCSVICGSVSS
ANILLDDQFQPKLTDFAMAHFRPHLEHQSSTISLASSSSKHLWYMPEEYIRQGKLSIKTD
VYSFGIVIMEVLTGCKVVLDEPKHIQLRDLLIELMEKRGLDSCISFLDKKVHPCPQNFSA
KLFSLAGQCAATRAKLRPSMDEVLTVLESSQASLYFAEDPPTSLKSFRSPSPLFFDNVPS
IPVEDDENQNNPSLPHDTGLRKDRLAQKTPFECSQSEVTYLGFDRKSGTKRNEDACNAAS
FPCEESSSSEHAAPSKDSRASPVPMDSSAEVPGHSCRSSRPVQTSSSSEVSWSECEPYRK
ASVSTEDGEESKCC
Download sequence
Identical sequences ENSSSCP00000029997 ENSSSCP00000029997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]