SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030045 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030045
Domain Number 1 Region: 679-845
Classification Level Classification E-value
Superfamily RNI-like 1.96e-34
Family 28-residue LRR 0.0088
Further Details:      
 
Domain Number 2 Region: 17-93
Classification Level Classification E-value
Superfamily DEATH domain 5.18e-16
Family Caspase recruitment domain, CARD 0.011
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000030045
Domain Number - Region: 192-293
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00312
Family RecA protein-like (ATPase-domain) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030045   Gene: ENSSSCG00000016678   Transcript: ENSSSCT00000033324
Sequence length 845
Comment pep:known chromosome:Sscrofa10.2:18:46956890:47012192:1 gene:ENSSSCG00000016678 transcript:ENSSSCT00000033324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKQGRSEMEVAPSESHSYIKLLKVNREHLVTHIRNTQCLVDNLLHNDYFSAEDAEIVCA
GPTQPDKVRRVLDLVQSKGEEVSEFFVFVLQQLADAYVDLRPWLAEIGFSPSQLVQSKAV
VNTDPVSRYSQKLRHQLGRDSKFILCYAQKEELLLEEMYTDTIMELVDFGNESLGSVGSL
ACLLDPSTGVLNKEGETIFIFGDAGVGKSMLLQRLQSLWASGQLDPGLKFFFHFRCRMFS
CFKESATLCLQDLLFKHYCFPEQDPEEVFTFLLRFPHTALFTFDGLDELHSDFDLSGEPD
TSSPWEPAHPLALLANLLSGKLLKGARKLLTARTGVEIPRQLLWKKVLLRGFSPSHLRAF
TRRMFPERAVRQRLLDQLEANPNLCSLCAVPLFCWIIFRCFQHFHDAFDSSLQLPDRTVT
LTDVFLLVTEVHLNRTQPTSLVQRNTRSQTETFRAGQGTLRSLGQVARWGMERSLFLFNQ
EEVQASEVQEGDLQLGFLRAVPELGLGGDQQSYEFLHLTLQAFFAALFLVVDDSVGPQEL
LRFFQEWVPPGEAEAASCFLPFLPGQCLGGRGLVGEDPFKNKDHFHFTNLFLCGLLSKGK
QKLLRHLVPAATLRRKRKALWAHLFSSLRSHLKNLPRVQSGGFSQVQAMPTFIWMLRCIY
ETQSEKVGQLAARGICANYLKLTFCNACSADCSALSFVLHHFRKQLALDLDNNNLNDYGV
RELQPCFSRLTVIRLSVNQITDSGVKVLYEELTKYKIVTFLGLYNNQITDVGARYVARIL
DECKGLKCLKLGKNKITSEGGKCLARAVKNSRSIFEVGMWGNQIGDEGAKAFAEALRNHP
SLTNL
Download sequence
Identical sequences ENSSSCP00000030045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]