SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030095 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030095
Domain Number 1 Region: 67-133
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000846
Family LIM domain 0.0013
Further Details:      
 
Domain Number 2 Region: 7-71
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000571
Family LIM domain 0.0027
Further Details:      
 
Domain Number 3 Region: 129-169
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000171
Family LIM domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030095   Gene: ENSSSCG00000012699   Transcript: ENSSSCT00000032876
Sequence length 194
Comment pep:novel chromosome:Sscrofa10.2:X:127285281:127288449:1 gene:ENSSSCG00000012699 transcript:ENSSSCT00000032876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECRKPIGADSKEVHYKNRY
WHDTCFRCSKCLHPLANETFMAKDNKILCNKCTTREDSPKCKGCFKPIVAGDQNVEYKGT
VWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVKCNKGLVKAPVWWPMKD
NPGTTTASTAKNAP
Download sequence
Identical sequences ENSSSCP00000030095 XP_013846458.1.46622 XP_020935188.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]