SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030140 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030140
Domain Number 1 Region: 27-85
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000373
Family TNF receptor-like 0.011
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000030140
Domain Number - Region: 7-37
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0673
Family TNF receptor-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030140   Gene: ENSSSCG00000003437   Transcript: ENSSSCT00000035406
Sequence length 109
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:66093819:66101261:1 gene:ENSSSCG00000003437 transcript:ENSSSCT00000035406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPQGPTDCRKQCDRGYYVDTNGRCTACVTCSEDYLVEKKPCSWNSSGVCECRAGMFCGTS
AVNSCARCLPHSVCPPGKVVKFQGESPHRATICVNTAPPPPRPPPPPSC
Download sequence
Identical sequences 9823.ENSSSCP00000003728 ENSSSCP00000030140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]