SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030179 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030179
Domain Number 1 Region: 91-151
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000314
Family TSP-1 type 1 repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030179   Gene: ENSSSCG00000012278   Transcript: ENSSSCT00000034008
Sequence length 156
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:47326248:47330577:1 gene:ENSSSCG00000012278 transcript:ENSSSCT00000034008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVQRSTCPPKGRPLSYCCCRCCCSPYQPQAQTLYSASPSMRNLRASARASLGGVSAWKIA
VSMLTTPSRRPAASSVCRAAFRTHICNTAVPCPVDGEWGLWGEWSNCVRRGIKHISCQEI
PGQQTRSRICKGRKFDGRRCLGEQQDIRHCYSIQRC
Download sequence
Identical sequences ENSSSCP00000030179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]