SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030300 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030300
Domain Number 1 Region: 4-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000105
Family Erythroid transcription factor GATA-1 0.0024
Further Details:      
 
Domain Number 2 Region: 329-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000502
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030300   Gene: ENSSSCG00000006018   Transcript: ENSSSCT00000034476
Sequence length 394
Comment pep:putative chromosome:Sscrofa10.2:4:24888153:24892807:1 gene:ENSSSCG00000006018 transcript:ENSSSCT00000034476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRRGSGVFCANCLTTKTSLWRKNANGGYVCNACGLYQKLHSTPRPLNIIKQNNGEQIIRR
RTRKRLNPEALQAEQLNKQQRGGSEEQVNGSPLERRSEDHLTEGHQREIPLPSLSKYEAQ
GSLTKSHSAQQPVLVSQTLDIHKRMQPLHIQIKSPQESTGDPGNSSSVSEGKGSSERGSP
IEKYMRPAKHPNYSPPGSPIEKYQYPLFGLPFVHNDFQSEADWLRFWSKYKLSVPGNPHY
LSHVPGLPNPCQNYVPYPTFNLPPHFSAVGSDNDIPLDLAIKHSRPGPTANGASKEKTKA
PSNVKNEGPLNVVKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSI
CQHLCTDKYDFTTHIQRGLHRNNAQAEKNGKPKE
Download sequence
Identical sequences ENSSSCP00000030300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]