SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030392 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030392
Domain Number 1 Region: 4-448,560-614
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.75e-84
Family GDI-like N domain 0.000000000000878
Further Details:      
 
Domain Number 2 Region: 448-559
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.88e-40
Family GDI-like 0.00000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030392   Gene: ENSSSCG00000012463   Transcript: ENSSSCT00000034932
Sequence length 653
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:78757338:79243045:-1 gene:ENSSSCG00000012463 transcript:ENSSSCT00000034932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENLPSEFDVIVIGTGLPESIIAAACSRSGQRVLHVDSRSYYGGNWASFSFSGLLSWLK
EHQENSNILSECSAWQEKILENEEAIALSRRDKTIQHVEVFCYASQDLDEDVEEAGALQK
NHASVTSAKSTEAADSACLPTEDESLSTASCEIPTEQTPRSDPKNALEVNDVEATGEKEN
RRDDKTCVPSTSEEETSENVPIAEDTAEQPKKNRITYSQIIKEGRRFNIDLVSKLLYSRG
LLIDLLIKSNVSRYAEFKNITRILAFREGRVEQVPCSRADVFNSKQLTMVEKRMLMKFLT
FCMDYEEYPDEYKAYEEISFSEYLKTQKLTPNLQYFVLHSIAMTSETASSTIDGLKATQN
FLHCLGRYGNTPFLFPLYGQGELPQCFCRMCAVFGGIYCLRHSVQCLVVDKESGKCKAII
DHFGQRIIAKHFIVEDSYFSENTCSRVQYRQISRAVLVTDKSVLKSNSDQQISILTVPAD
EPGAFAVRVIELCSSTMTCMKGTYLVHLTCTSSKTAREDLEPVVQKLFTPYTETEIENEE
VEKPRLLWALYFNMRDSSDVSRNSYNDLPSNVYVCSGPDCGLGNDNAVKQAEALFQQICP
KEDFCPPPPNPEDIILEGDSLQPEALESSAIPEASSETPKESANLGNPEEPSE
Download sequence
Identical sequences K7GL59
ENSSSCP00000030392 XP_003135267.4.46622 ENSSSCP00000028588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]