SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030497 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030497
Domain Number 1 Region: 5-70
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000349
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030497   Gene: ENSSSCG00000005941   Transcript: ENSSSCT00000036563
Sequence length 207
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:6128156:6213993:-1 gene:ENSSSCG00000005941 transcript:ENSSSCT00000036563 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XEELRKSGEAKYFHLNDDLHVLIEVFAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQL
QELTYLNGGSENADVPVVRGKPTLRTRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPP
PPTQETYGDYDYDDGYGTAYDEQSYDSYDNSYSAPAQSGADYYDYGHGLSDDTYDSYGQE
EWTNSRHKAPSARTAKGVYRDQPYGRY
Download sequence
Identical sequences ENSSSCP00000030497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]