SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030525 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030525
Domain Number 1 Region: 559-902
Classification Level Classification E-value
Superfamily RNI-like 1.08e-58
Family 28-residue LRR 0.000099
Further Details:      
 
Domain Number 2 Region: 10-97
Classification Level Classification E-value
Superfamily DEATH domain 1.77e-24
Family Pyrin domain, PYD 0.0077
Further Details:      
 
Domain Number 3 Region: 149-328
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000358
Family Nucleotide and nucleoside kinases 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030525   Gene: ENSSSCG00000003315   Transcript: ENSSSCT00000034314
Sequence length 902
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:55500444:55519969:1 gene:ENSSSCG00000003315 transcript:ENSSSCT00000034314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSPSSSSTFPFKNGVMLYLIYLSKENLQRFKQLLLEEIPRPGSIPITWDQVQMARWAEVA
HLLTECFPGRLAWDVTHDIFSKMNQTELCLRVQMELNGKIQEYKRRVMDEYSTLLDRTTW
PGNHTDFFYQDVCREETFLPCLLLPRRPQGRQPKTVVLRGVAGIGKTSQAKMVMSAWAKN
RFYPHKLWFAFYIHCQDSDQVDEQSFCELIARKLSGTQALASKILSKPDQLLLLLDGFED
LTWTLTDRPEDLSEDWNRKLPWSVLLTSLLSKRMLPEATLLIFLRFPFWKNVSPFLKCPS
VITLTGFSVPERTRYFRTYFGNENEAEEALGFVMGNTILFSMCQVPVICWLVCYCLKQQM
GRGANLPQTYPNATAVFVHYLSGLFPTKAKHLSQKTHQEQLKGLCSLAAEGMWERRWVFN
KTHLKLARLDETDVATFLSLSIFRRVAGKEDLYAFTLLTFQEFFAALLYVLCFPKRLRNF
HALDQFYILRLIAHPRRKRNHLAQMALFLFGLFNETCTLAVEQRFGCKVSWGNKKKLLKT
ASLPHESDPPTLHHGVPQLFNCLHEIQEEAFVSQTLSDCRRAVLVVNRNKDMQVSAFCLK
RCRRLQALELTVNLIVTKAGHHFLFSPFCAPRSEGHERSSLWWQDFCSIFKTLENLEVLA
VTHSTVDADSLMVLSSALTHPHCKLQKLIFRHVSPLMLNEDLIRVLVENQHLRSLEIQAT
EVRCQVMEFLCHTLKHPRCFLQCLRLENCDLTLLSCKSLIYSLESNKNLTHLSLAKNSLK
DDGAKQLWDALQHTRHPLQRLVLRNCALTSDCCQNMASALNKNKTLRSLDLGFNSLKDDG
VIMLCQPLMDPDSGLQVLELENCLFTSSCCEAMASVLLSNQSLRYLDLSKNDIQCHGVRF
LC
Download sequence
Identical sequences ENSSSCP00000030525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]