SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030589 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030589
Domain Number 1 Region: 142-184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000301
Family LDL receptor-like module 0.00014
Further Details:      
 
Domain Number 2 Region: 104-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000157
Family LDL receptor-like module 0.00016
Further Details:      
 
Domain Number 3 Region: 197-233
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000183
Family LDL receptor-like module 0.00023
Further Details:      
 
Domain Number 4 Region: 26-62
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000471
Family LDL receptor-like module 0.00027
Further Details:      
 
Domain Number 5 Region: 62-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000103
Family LDL receptor-like module 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030589   Gene: ENSSSCG00000030900   Transcript: ENSSSCT00000033970
Sequence length 236
Comment pep:known chromosome:Sscrofa10.2:2:70193418:70206818:-1 gene:ENSSSCG00000030900 transcript:ENSSSCT00000033970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSTGWVLRWAVALLIAAVAAAVEEKCGRNEFQCRDGKCISYKWICDGNTECKDGSDESL
ETCMSVTCKIGDFSCGGRVNRCIPESWRCDGQQDCENGSDEEGCSPKTCSQDEFRCQDGK
CIAPKFVCDSDRDCLDGSDEASCPTPTCGPASFQCNSSTCIPELWACDGDPDCEDGSDEW
PQHCRSHSSSLPERSNNPCSALEFHCHSGECIHSSWRCDGDTDCKDKSDEENCGRG
Download sequence
Identical sequences ENSSSCP00000030589 ENSSSCP00000030589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]