SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030708 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030708
Domain Number 1 Region: 116-302
Classification Level Classification E-value
Superfamily L domain-like 1.87e-36
Family Ngr ectodomain-like 0.024
Further Details:      
 
Domain Number 2 Region: 785-885
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-20
Family DEATH domain, DD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030708   Gene: ENSSSCG00000012843   Transcript: ENSSSCT00000033991
Sequence length 913
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:169513:175054:1 gene:ENSSSCG00000012843 transcript:ENSSSCT00000033991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVVEEQEPEPSAAEDAARDATDAVAVGPGTLPLLAGNRLSLDLYPRGCHRLLHLCAQQ
VPQLLEVEFLQLSGHEDPRLLEATLAQLPSSLPHLRSLVVKGGQHRDAQGACLRGSLATL
PAGLNGLVRLAHLDLSFNSLETLPACVPQMCGLGALLLSHNCLSELPEALGALCALTFLA
VTHNRLQTLPTALGSLSTLQRLDLSENLLDTLPPEIGGLSSLAELNLASNRLQSLPASLA
GLRSLQLLVLHSNLLASVPAGLARLPLLTRLDLRDNQLRDVPPELLDAPFVRLQGNPLSG
SPPTPRSPPGTPVVPKMPSLLLSSDLDSFAVTPLGCSVTLTCGVRLRFPAGATATPVTVR
YRLWLPEPRLVPLGPHDSLLSGVLELQPHGVAFQQEVGLWLLFVPPRARRCREVVVRTLS
DNSWSDLETHLEEEAPKRLWAHCQVPHFSWFLVVSRPVSDACLVPPEGTLLCSSGHPGVK
VTFPPGATEEPRHVRMQVVRVGSRELPALLREPEAAASPLLCLSQSGPLSFLRPVTVQLP
LPPGITGLSLDRSCLHLLHRAPPAATWDDITAQVALELTHLYARFQVTRFSWYWLWYTTK
ACVGGLARKAWERLRLHRVNLIALQRRRDPEQVLLQCLPRHKVDATLRRLLERYRGPEPS
DTVEVFEGEKFFAAFERGIAVDADRPDCVEGRVCFVFYSHLKNLKEVYVTTALDRRAQAV
RGQVSFYRGEVPAEVPEEAEAARQRRGADALWMATLPIKLPRLRGSEEPAQGPGLSLAPL
NLGDAETGFLTQSNLLNVAGRLGPDWPAVALHLGVPYRQLQRIRHEFRDDLDGQIRHMLF
SWAERQAGQPGAVGLLVQALEQSDRRDVAEEVRAVLELGRRKYQEGIRRTSLAPGDLALR
GPSSSPSPEPAQA
Download sequence
Identical sequences ENSSSCP00000013653 ENSSSCP00000030708 ENSSSCP00000013653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]