SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030721 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030721
Domain Number 1 Region: 33-114
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000753
Family Growth factor receptor domain 0.0057
Further Details:      
 
Domain Number 2 Region: 207-250
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000235
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030721   Gene: ENSSSCG00000006002   Transcript: ENSSSCT00000033922
Sequence length 358
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:20525290:20533993:-1 gene:ENSSSCG00000006002 transcript:ENSSSCT00000033922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRAQSLRLGLPKRCLCLAFLLLHLLGQVAATQRCPPSCPAPCPKKPPTCAPGVRAVLDD
CSCCLVCARQRGESCSVMLPCEESRGLFCDRRADPSAQTGICMAIEGDNCVFDGVIYQSG
ETFQPSCKYQCACQDGQVGCVPRCEEDLLLPQPDCPAPRKVKVPGECCEKWICDSNETGT
LGDLQTLPAYRTEATVGVAISDSGTNCIEQTTEWSACSKSCGMGFSTRVTNRNPHCEMVK
QTRLCLVRPCDQEHTQPTDKKGKKCLRTTKSLKAIHLQFENCTSLHTYRPRFCGVCSDGR
CCTPHSTKTIRVQFRCSPGKTIQKPVMVIGTCTCHNNCPHNNASFLQDLKPNTSRGEM
Download sequence
Identical sequences F1S279
9823.ENSSSCP00000006411 ENSSSCP00000006411 ENSSSCP00000030721 XP_001927085.1.46622 ENSSSCP00000006411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]