SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Sus scrofa 76_10.2 > ENSSSCP00000030724

Domain assignment for ENSSSCP00000030724 from Sus scrofa 76_10.2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSSSCP00000030724
Domain Number 1	Region: 2-58
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	1.7e-16
Family	TSP-1 type 1 repeat	0.00023
Further Details:

Domain Number 2	Region: 352-411
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.0000000000353
Family	TSP-1 type 1 repeat	0.0056
Further Details:

Domain Number 3	Region: 300-354
Classification Level	Classification	E-value
Superfamily	TSP-1 type 1 repeat	0.0000000000902
Family	TSP-1 type 1 repeat	0.0033
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSSSCP00000030724 Gene: ENSSSCG00000029488 Transcript: ENSSSCT00000036599
Sequence length	412
Comment	pep:novel chromosome:Sscrofa10.2:13:200327943:200332110:1 gene:ENSSSCG00000029488 transcript:ENSSSCT00000036599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	TPVHGSWGPWGPWGDCSRTCGGGVQYTMRECDNPVPKNGGKYCEGKRVRYRSCNIEDCPE NNGKTFREEQCEAHNEFSKASFGSGPPVEWTPKYAGVSPKDRCKLICQAKGIGYFFVLQP KVVDGTPCSPDSTSVCVQGQCVKAGCDRIIDSKKKFDKCGICGGNGSTCKKISGSVTSAK PGYHDIVTIPTGATNIEVKQRNQRGSRNNGSFLAIKAADGTYILNGDFTLSTLEQDITYK GSVLRYSGSSAALERIRSFSPLKEPLTIQVLTVGNALRPKIKYTYFVKKKKESFNAIPTF SEWVIEEWGECSKTCGLGVQRRLVECRDINGQPASECAKEVKPASTRPCADLPCPHWQLG DWSPCSKTCGKGYKKRTLQCLSHDGGVLAHESCDPLKKPKHYIDFCTMAECS
Download sequence
Identical sequences	ENSSSCP00000030724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]