SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030780 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000030780
Domain Number 1 Region: 608-909
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.61e-72
Family WD40-repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 961-1238
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.05e-57
Family WD40-repeat 0.00038
Further Details:      
 
Domain Number 3 Region: 107-367
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.15e-44
Family RecA protein-like (ATPase-domain) 0.068
Further Details:      
 
Domain Number 4 Region: 1-92
Classification Level Classification E-value
Superfamily DEATH domain 6.12e-23
Family Caspase recruitment domain, CARD 0.00000809
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030780   Gene: ENSSSCG00000000884   Transcript: ENSSSCT00000033603
Sequence length 1249
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:89443057:89577372:-1 gene:ENSSSCG00000000884 transcript:ENSSSCT00000033603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAKARNCLLQHREALERDIKTSYIMDHMISNGVLTLSEEEKVKNEPTQCQRAALLIKMI
LKKDNYAYISFYNALLHEGYKDLAALLHGGLPVVSSSNSKDSVAGITSYVRTVLCEGGVP
QRPVVFVMRKKLVNAVQQKLFKLNGEPGWVTIYGMAGCGKSVLAAEAVRDHSLLEVCFPG
GVHWVSIGKQDKSGLLMKLQNLCARLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDIWDPWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVIPVESGLGKEKGLEILSLFVN
MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWDYYLRQLQNKQFKRIKKSSSYD
YEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGKSFLYYLHDLQVDFLTEKNRSQLQDLHKKMITQFQRHHRLHTLSPDQEDC
MYWYNFLAYHMASANMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDGTV
CENFQEFLSLNGHLLGRQPFPNIVQLGLCELETSEVYRQAKLQAKQEVDNGMLYLEWINK
KNIKNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
LCCAFSADDRFIATCSVDKKVKIWNSVTGELVQSYDEHSEQVNCCHFTNNSNHLLLATGS
SDYFLKLWDLNQKECRNTMFGHTNSVSHCRFSPDDKLLASCSADGTLKLWDVKSANERKS
INVKQFFLNSEESQEDMEVMVKCCSWSADGASLVVAAKNKVLLFNIHTGGLLAEIHTGHH
STIQYCDFSPSNHLAVVALSQYCVELWNMDSCLKVADCRGHLSWVHCAMFSPDGSSFLTS
SDDETIRLWETKKVCKNSAIVLNKKIDVVFQENEVMVLAVDNIRRLQVINGKTGQIDYLT
EAQVSCCCLSPHLQYLAFGSDDGAIQVLELLNNRLFQSRTRHKNTVRHIQFTTDGKNVIS
SSDDSAIQVWNWQSEETVSLQAHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGRIEKD
FVCHQDTVLSCDISPDATKFSSTSADKTAKIWSFDLLSPLHELRGHKGCVRCSAFSVDST
LLATGDDNGEIRIWNVSNGELLHSCAPVLVEGGAATHGGWVTDLRFSPDGKMLVSAGGYL
KWWNVDSGKSIQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYVLKILE
Download sequence
Identical sequences ENSSSCP00000000947 ENSSSCP00000030780 ENSSSCP00000000947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]