SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030947 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000030947
Domain Number - Region: 470-556
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0314
Family Di-heme elbow motif 0.067
Further Details:      
 
Domain Number - Region: 605-631
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0641
Family A20-like zinc finger 0.051
Further Details:      
 
Domain Number - Region: 656-685
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0998
Family A20-like zinc finger 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030947   Gene: ENSSSCG00000004154   Transcript: ENSSSCT00000034426
Sequence length 785
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:29825892:29841626:-1 gene:ENSSSCG00000004154 transcript:ENSSSCT00000034426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQLLPLALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKSMHRYTLEMFRTCQFCPQF
REIIHKALIDRNIQASLESQKKLNWCREVRKLVALKTNGDGNCLMHAASQYMWGVQDTDL
VLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWTEEWDNLIKMASTDTP
VARSGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPA
QECYRYPIVLGYDSQHFVPLVTLKDSGPEIRAIPLVNRERGRFEDLKVHFLTDPENEMKE
KLLKEYLTVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENN
EQGRRATHPQNPLEPSVPQLSLMDIKCETPNCPFFMSVNTQPLCHECSERRQKNQSKPPK
PTSKPDPEALPGLALGASRGEAWNPEEPSGGPRSAPPTAPSLFLFSETTAMKCRSPGCPF
TLNVQHNGFCERCHNARQLNPGHPPDPTRHLDPSKCQACLQNVTRTFNGICSTCFKRTTA
EPASSLGSSIPLSCHQRSKSDPSQLAQSVSPHPCRRAGPEAPSGCSASAARTPGDRTGTS
KCRKAGCMYFGTPENKGFCTLCFIEYRENKHFVTASGKASPTASRFQNAVPCLGRECGAL
GSTVFEGYCQKCFIEAQNQRFHEAKRTEEQLRLSQRRDLSRATQSASRSKCARATCRNVL
ACCSQELCIECQPLGQRVSPGARRPEPVPEDPPTQRCRAPACDHFGNAKCNGYCNECFQF
KQMYG
Download sequence
Identical sequences F1S6A4
XP_005659239.1.46622 XP_013847984.1.46622 XP_020933283.1.46622 ENSSSCP00000004489 ENSSSCP00000004489 ENSSSCP00000030947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]