SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030952 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000030952
Domain Number - Region: 23-60
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 0.00216
Family Interleukin 8-like chemokines 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030952   Gene: ENSSSCG00000010414   Transcript: ENSSSCT00000032621
Sequence length 90
Comment pep:novel chromosome:Sscrofa10.2:14:99990230:99999776:1 gene:ENSSSCG00000010414 transcript:ENSSSCT00000032621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVKVLAVLALVLTALCLSDEKPVSLSYRCPCRFFESHVARANIKHLKILNTPNCALQIV
GRREEKVGKKEKIGKKKRQKKRKAAQKRKN
Download sequence
Identical sequences ENSSSCP00000030952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]