SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000030973 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000030973
Domain Number - Region: 79-181
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0157
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000030973   Gene: ENSSSCG00000014878   Transcript: ENSSSCT00000035648
Sequence length 275
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:12980354:13061274:-1 gene:ENSSSCG00000014878 transcript:ENSSSCT00000035648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDEDDD
DDATPPPVIAPRPEHTKSVYTRSVIEPLPITPTRDVATSPISPTESTTTPPDALTRNTEK
QKKKPKMSDEEILEKLLTSWEMNCGLSWNTWLEVL
Download sequence
Identical sequences ENSSSCP00000030973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]