SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000031059 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000031059
Domain Number 1 Region: 132-408
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.05e-78
Family Nuclear receptor ligand-binding domain 0.00000000164
Further Details:      
 
Domain Number 2 Region: 80-159
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.03e-30
Family Nuclear receptor 0.0000142
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000031059
Domain Number - Region: 53-93
Classification Level Classification E-value
Superfamily Hydrophobin II, HfbII 0.00942
Family Hydrophobin II, HfbII 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000031059   Gene: ENSSSCG00000001474   Transcript: ENSSSCT00000036293
Sequence length 414
Comment pep:known chromosome:Sscrofa10.2:7:29762013:29766492:1 gene:ENSSSCG00000001474 transcript:ENSSSCT00000036293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPV
LGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRD
NKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPVDR
ILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSL
PLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRSLSR
VLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKY
PEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
Download sequence
Identical sequences A5D9P5 F7HA78 M3W6V1
XP_014303093.1.53796 XP_014332370.1.15283 XP_016866665.1.92137 XP_019516491.1.44202 XP_019594251.1.88060 ENSSSCP00000031059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]