SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001275 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001275
Domain Number 1 Region: 44-135
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.02e-37
Family SCAN domain 0.0000606
Further Details:      
 
Domain Number 2 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 264-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.38e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-19
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 420-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-17
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 6 Region: 223-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000175
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001275   Gene: ENSSSCG00000001206   Transcript: ENSSSCT00000001304
Sequence length 478
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:24064646:24076227:1 gene:ENSSSCG00000001206 transcript:ENSSSCT00000001304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTLVTAYSPAPLNLKKGGLRVVEENHCSAREQGVKLQGKSTGLGQEPLCKQFRQLRYE
ETAGPREALSRLRELCRQWLQPETHSKEQILELLVLEQFLTILPEELQARVREHHPESGE
DVVVVLEDLQSELGGAGQQVDPDQAKKQKMPVEETAPLKAVLEQQVQPECDVPKPEREKG
KETKIANGKLVVEKGSCGGVESSGKISEPKETHYKDSDLDRQQIKPKEIDYKCSECGEGF
IHHSDLIKHEGLHKGEKLCESEASQSSNLTGLQKIHSREKGHQCDECGKAFQRSSHLVRH
QKIHLGEKPYQCKECGKVFSQNAGLLEHLRIHTGEKPYLCIHCGKNFRRSSHLNRHQRIH
SQEEPCECKECGKTFSQALLLTHHQRIHSHSKGHQCNECGKAFSLTSDLIRHHRIHTGEK
PFKCTICQKAFRLNSHLAQHVRIHNEEKPYGCKECGEAFRQRSGLFQHQRYHHRDKLA
Download sequence
Identical sequences 9823.ENSSSCP00000001275 ENSSSCP00000001275 ENSSSCP00000001275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]