SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001723 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001723
Domain Number 1 Region: 32-155
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.7e-30
Family Hormone receptor domain 0.0018
Further Details:      
 
Domain Number 2 Region: 137-425
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000011
Family Rhodopsin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001723   Gene: ENSSSCG00000001589   Transcript: ENSSSCT00000001769
Sequence length 466
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:39595053:39623436:1 gene:ENSSSCG00000001589 transcript:ENSSSCT00000001769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAPAPSVLSVATGWTLRTGRIKMGRHPLQGTTVSLSETVQKWREYRRQCQRFLTEAPPPA
TGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTADGLWLHKDNSS
LPWRDLSECEESKHGDRSSPEEQLLSLYVIYTVGYALSFSALVIASAILLGFRHLHCTRN
YIHLNLFASFILRALSVFIKDAALWMYSTAAQQHQWDGLLSYQDSLGCRLVFLLMQYCVA
ANYFWLLVEGVYLYTLLALSVFSEQRIFRLYLSIGWGVPLLFVIPWGIVKYLFEDEGCWT
RNSNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKLKANLMCKTDTKCRLAKSTLTLIP
LLGTHEVIFAFVMDEHARGMLRFIKLFTELSFTSFQGLMVAILYCFVNNEKVQMEFRKSW
ERWRLEHLHIQRDSSMKPFKCPTSSLSCGATVGSSVYSASCQASCS
Download sequence
Identical sequences ENSSSCP00000001723 9823.ENSSSCP00000001723 ENSSSCP00000001723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]