SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001960 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001960
Domain Number 1 Region: 1070-1146
Classification Level Classification E-value
Superfamily Immunoglobulin 1.08e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 683-757
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000103
Family I set domains 0.046
Further Details:      
 
Domain Number 3 Region: 466-519
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000929
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 967-1045
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000124
Family I set domains 0.036
Further Details:      
 
Domain Number 5 Region: 327-382
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000405
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 6 Region: 176-236
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000497
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 1186-1244
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000131
Family TSP-1 type 1 repeat 0.0049
Further Details:      
 
Domain Number 8 Region: 231-291
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 9 Region: 1248-1305
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000017
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 10 Region: 520-579
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000275
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 11 Region: 575-640
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000209
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 12 Region: 98-158
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000288
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 13 Region: 408-463
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000772
Family TSP-1 type 1 repeat 0.0086
Further Details:      
 
Domain Number 14 Region: 1364-1419
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000916
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001960   Gene: ENSSSCG00000001793   Transcript: ENSSSCT00000002009
Sequence length 1455
Comment pep:novel chromosome:Sscrofa10.2:7:56500840:56671956:-1 gene:ENSSSCG00000001793 transcript:ENSSSCT00000002009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EENVIAVPLGSRSVRITVKGPAHLFIESKTLQGSKGEHSFNSPGVFVVENTTVEFQRGSE
RQTFKIPGPLMADFIFKTRYTAAKDSVVQFFFYQPISHQWRQTDFFPCTVTCGGGYQLNS
AECVDIRLKRVVPDHYCHYYPENVKPKPKLKECSMDPCPSSDGFKEIMPYDHFQPLPRWE
HNPWTACSVSCGGGIQRRSFVCVEESMHGEILQVEEWKCMYAPKPKVMQTCNLFDCPKWI
AMEWSQCTVTCGRGLRYRVVLCINHRGQHVGGCNPQLKLHIKEECIIPIPCYKPKEKSPV
EAKLPWLKQAQELEETRIATEEPMFIPEPWSACSTTCGPGIQVREVKCRVLLTFTQTETE
LPEEECDGPPLPTERPCLLEPCDESPTSREPAATVSLQEKDSEMTYDWEYAGFTPCTATC
LGGRQEAIAVCLHIQTQQTVNDTLCDTVHRPPAMSQACNTEPCPPRWHTGSWGPCSATCG
VGIQTREVYCVHPGESPSPPEECREERPHALQACNQFDCPPSWHIEEWQQCSRTCGGGTQ
NRRVTCRQLLTDGSFLNLSDELCQGPKASSHKSCARTDCPPHVTMGDWSKCSVTCGVGTQ
RRKQVCQRLTAKGRRVPLSETMCRHLPGAPLVRSCQMPVCRKMKPEVKTKLGEQGPQILG
VQRVYIQTREEKRINLTVGSRAYLLPNTSVIIKCPVRRFQKSLIQWEKDGRCLQNSKRLG
ITKSGSLKIHSLTAPDIGTYQCIAGSAKETVVLKLIGTDNRLIAPPALRGHLMEYPGMDH
NEANNLGATWHKMRQMWSTKNELYLDDGQINNQPLLRALLGHCSNSAGNANSWEFKNKQF
EAAVKQGAYSMDTAQFDEMIRNMSQLIETGEVSDDLASQVIYHLVAELAKAQAPAHAPWR
GIPEEAPPAAHLRGETGSVPQSSNVKDSGKLTFKPKGPVLLRQSQPTSISFNKTVNARIG
DTVYITRRTEVINILCELDTPSEATYMWTKDGASLQPSAKVILDGMGKIQIQKPTKKDQG
VYGCSVANHLGSDVESSSVLYAEAPVILSIERNITRPEHSHLSVVIGGIVEAPLRANVTI
QCPVKGIPQPNITWLKKGGSLSDSISLLFNGSLLLQNVSLENEGTYVCTAINALGKAKAT
SVLHLLEQRQSDSKIIFPKGHKKHMLQASNTGANSQQETPYLQQTEPFWELGNWTHCSAT
CGHLGARVRRPQCVMANGQEVSESLCNHLQKPLAGYQPCNLQDCPSRWFTSTWSQCSVSC
GEGFRSRQVTCKRTRANGTVQVMSPRACALKDKPLGRRPCASHPCVQGAIEPGSQCPGRC
LGHAVRMQQPHVICQLHNSSDSDCDDRRRPSLKRNCSSEACDTCWYTGPWRPCTAACGRG
FQSRKVDCVHTRSCKPVAERRCVSRRKPTSWRHCLGPSCDRDCTDTTHYCTFVKHLHLCS
LDLYKQRCCQSCQEG
Download sequence
Identical sequences ENSSSCP00000001960 ENSSSCP00000001960 9823.ENSSSCP00000001960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]