SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003175 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003175
Domain Number 1 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.3e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.54e-25
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 150-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.79e-25
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.94e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 598-655
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-24
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 6 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 8 Region: 542-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 9 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.51e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 10 Region: 206-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 11 Region: 100-151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.31e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 12 Region: 640-692
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003175   Gene: ENSSSCG00000029600   Transcript: ENSSSCT00000003256
Sequence length 697
Comment pep:novel chromosome:Sscrofa10.2:6:42004516:42031583:-1 gene:ENSSSCG00000029600 transcript:ENSSSCT00000003256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFQESVIFKDVCVNFSLEEWECLDLTQRNLYRCVMLENYSNLVSVGLSIPKPDVISLLEQ
GKEPWGVFDSEMTRGLNQDCGSRCEKDSHIKFTLVRNHLCVRRHQRIHTGEKPYECKECG
KAFKSASYFFIHHRIHTGEKPYECEKCAKTFRSSSALNRHQRVHTGEKPYVCKDCEKAFC
SSSKLIEHQRIHTGEKPYVCKECGKAFYYSSGLSQHCGTHMGEKPYKCKECGKTFSSSSA
IVRHKRIHTGEKPFECKECRKAFHLSADLSQHQRIHKGEKLYECHECGKVFRKITYLTYH
QRIHTGEKPYECKECGKAFIRSSHLTQHQRIHTGERPYECNECGKAFFRGSQLTYHQRVH
TAEKPYQCKECGKAFIRGSQLTEHQRIHTGEKPYECKKCGKAFSYGSQLTLHHRLHTGEK
PYKCKDCDMSFIRGSQLTEHQRIHTGKKPHECKQCGKAFNYGSQLIRHQRIHTGEKPYEC
QQCGKSFIRGSQLTEHQKIHTGEKPFECKECGKAFIRGSHLTQHQRIHTGEKPYECKQCG
KAFIYGSQLSQHQRIHTGENPYECKQCGKIFICASQLNLHQIFHTGRKPYECKECGKTFI
RGSQLTYHQRVHSGEKPYECSECGKAFIRGSHLTQHQRIHTGEKPYKCNECRKAFNRGSQ
LTQHLRIHSGEKPYKCNECSKDFRRHSHLTQHQKLHD
Download sequence
Identical sequences ENSSSCP00000003175 ENSSSCP00000003175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]