SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003237 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003237
Domain Number 1 Region: 580-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.8e-24
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 2 Region: 720-777
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.86e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 19-79
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.28e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 384-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.44e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 272-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.5e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 328-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 636-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 524-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-22
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 9 Region: 440-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.76e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 10 Region: 216-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.26e-20
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 11 Region: 165-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.36e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 683-715
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000177
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 13 Region: 487-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000597
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003237   Gene: ENSSSCG00000002988   Transcript: ENSSSCT00000003319
Sequence length 799
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:44194900:44201718:1 gene:ENSSSCG00000002988 transcript:ENSSSCT00000003319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPAEEAQRALTSSCSSRTMAHMSLSFTDVAIDLSQEEWECLDLDQRALFREVMLENYRNL
VSLGCPTPKPDVITLLEQEKEPWVVMREGTRNWYTDLESKYVTNKLFPEKDICEIYLSQL
KIVNKSKTYMHEDTTFRNDMQCKHEFGRQGHQMKCARQMIIQKHISLPLHQKIHAIEKSY
ECKECRKAFRQQSYLIQHLRIHTGERPYKCKECGKAFCRVGDLRVHQTIHAGERPYECNN
CGKTFRLHYHLTEHKRIHSGVKPHACKECGKAFSRVRDLKVHQTIHAGERPYECKDCGKT
FRLHYQLTEHQRIHTGERPYKCKICGKTFRVQRHISQHQKIHTGVKPYKCNDCGKAFSHG
SYLVQHQKIHTGDKPYECKECGKSFSFHAELTRHHRIHTGEKPYECKECGKAFRLQTELT
RHCRIHTGEKPYECKECGKAFICGYQLTLHLRAHTGEIPYECKECGKTFSSRYHLTQHYR
IHTGEKPYGCKECGKAFRLQAELTRHHRIHTCEKPYECKECGKAFIRSNQLISHQRIHTN
ENTYECKECGKIFSRRYNLTQHYKIHTGEKPYLCKECGKVFRFQTELTQHRRIHTGEKPY
KCQECGKAFIRSNHLTQHHRIHTGEKPYECKECGKTFSRHYHLTQHHRIHTGEKPYRCNE
CGEAFICSYQLTLHQRIHTGEIPYECKECGKTFSRRYHLTQHFRLHTGEKPYGCKECGDA
FRLQAELTRHHTVHTGEKPYKCQECEKAFSVKSELTRHHRIHTGERPYKCKECGKAFIRS
DQLTLHQRNHINEVTLCLM
Download sequence
Identical sequences ENSSSCP00000003237 ENSSSCP00000003237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]