SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003316 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003316
Domain Number 1 Region: 29-125
Classification Level Classification E-value
Superfamily Snake toxin-like 1.04e-23
Family Extracellular domain of cell surface receptors 0.038
Further Details:      
 
Domain Number 2 Region: 137-226
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000107
Family Extracellular domain of cell surface receptors 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003316   Gene: ENSSSCG00000003062   Transcript: ENSSSCT00000003399
Sequence length 346
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:46263688:46267709:1 gene:ENSSSCG00000003062 transcript:ENSSSCT00000003399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPAGKAGAGAVIWTTGWLLLLPLLLAEGAQALECYSCVQKADDGCSPQKMKTVKCAPGV
QVCTEAVGAVETIHGQFSVAVRGCGSGLPGKNDRGLDLYGLLAFIQLQQCSQDRCNAKLN
LTSRGLNPAGNESAYGPNGVECYSCVGLSREACQGTAPPVVRCYNASDHVYKGCFDGNVT
LTAANVTVSLPVRGCVQDEFCTRDSVTGPGFTLSGSCCQGSRCNSDLRNKTYFSPRLPPL
VLLPPPPSTTLAPTTSVTTSTPAPTTFTSTSKPTPARTSQIPQKVETENSQETESSLVGG
AGGHQDRRNMGQYPTKNEPHYNNKGSAAPSAGLAALLLAAAVGILL
Download sequence
Identical sequences F1RMV7
ENSSSCP00000003316 9823.ENSSSCP00000003316 ENSSSCP00000003316 XP_003481923.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]