SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003520 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003520
Domain Number 1 Region: 328-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.28e-26
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 665-721
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.18e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 271-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-24
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 4 Region: 721-777
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 553-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 6 Region: 496-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.55e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 609-665
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 215-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.99e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 9 Region: 4-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 10 Region: 818-870
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-21
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 11 Region: 777-833
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 12 Region: 384-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-21
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 13 Region: 439-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.06e-21
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 14 Region: 179-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-17
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003520   Gene: ENSSSCG00000003243   Transcript: ENSSSCT00000003603
Sequence length 879
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:52011706:52051380:1 gene:ENSSSCG00000003243 transcript:ENSSSCT00000003603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKDQGSLTLEDVAVDFTWEEWQLLTPDQKDLYRDVTLENHRNLVAVGYQALKPDALSRL
ERGKLWPEEDEILGQICPAMSVWKRGSSLHEPLIVSLPSPNHIFESRTQGQLCLFSKRNF
PLKQNHNIFDLRGKALKLNLVSQSRSYKGKNPVEVNGDTKSFLHAKREQFHVEIKFPEHV
CTECGKAFVKKSRLIDHQRVHTGEKPHGCSVCGKAFSRKSRLSEHQKTHIGEKPYVCDEC
GKGFIKKSRLINHQRVHTGEKPHGCSLCDKAFSRKSRLIEHQRTHTGEKPYECTECDKAF
RWKSQLNAHQKTHTGEKSYVCSECGKGFIQKGNLIVHQRTHTGEKPYVCSECGKGFIQKG
NLLIHQRTHTGEKPYVCTECGKGFSQKTCLISHQRFHTGKTPFVCTECGKSCSHKSGLIN
HQRIHTGEKPYRCNDCGKAFRDKSCLNRHRRTHTGERPYGCTDCGKAFSHKSQLTDHQRV
HTGEKPYGCSSDCGKVFTMKSRLIEHQRTHTGEKPYVCNECGKGFPGKRNLIVHQRNHTG
EKCYVCGECGKGFTGKSMLTIHQRTHTGEKPYICSECGKGFTTKHYVIIHQRNHTGEKPY
ICNDCGKGFTMKCRLIEHQRTHTGEKPYVCPECGKGFPRKSNLIVHQRNHTVEKSYVCSE
CGKGFTVKSMLIIHQRTHTGEKPYICSECGKGFPLKSRLVVHQRTHTGEKPYRCSECGKG
FIVNSGLMLHQRTHTGEKPYICNKCGKGFAFKSNLVVHQRTHTGEKPFMCSECGKGFTMK
RYLVVHQQIHTGEKSYICRECGKGFVTETELILHQQTHTGEKPFACNECGKGFTVKSRLV
VHQRTHTGEKPFVCSECGKAFSSKRNLIVHQRTHNGNKP
Download sequence
Identical sequences ENSSSCP00000003520 ENSSSCP00000003520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]