SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003521 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003521
Domain Number 1 Region: 271-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 326-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.78e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 383-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.9e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 719-775
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 5 Region: 550-607
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.53e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 438-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 494-551
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.18e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 8 Region: 214-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.32e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 662-719
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 10 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-20
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 11 Region: 774-831
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 12 Region: 816-868
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.46e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 13 Region: 606-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 14 Region: 175-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000034
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003521   Gene: ENSSSCG00000003244   Transcript: ENSSSCT00000003604
Sequence length 877
Comment pep:novel chromosome:Sscrofa10.2:6:51959390:51992422:-1 gene:ENSSSCG00000003244 transcript:ENSSSCT00000003604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSLSFKDVAVVFTWEEWQLLDPIQKNLYQDVMLENYINLVSMVGYQVTNTDSFYQLEQER
PWIIEEEIQNQIHPGTQVDNHRDWHKGNHGNLETMENHQKENAFGKISSLSLNLDVSLAQ
ISHTFDILEKHLKPNLQYIIQNKGHLRNEIDFNQYDKLFLYTKYEKIHTGQKYTEKHCIG
SDCGKAFSQKSDLIKHHRAHRGEKPYGCSRCQKAFSQKSHLILHQRTHMGEKPYECNKCG
KAFTDKSCLNKHQRTHTREKRFECRVCQTGFSDKSQLTLHQRTHTGEKPYRCGECQKSFS
NKSQLIIHQRSHTGEKPYGCKECGKTFPLKFSLILHQKTHTGEKPYGCNECGKAFIQRSE
LIRHQRTHTGAKPYNCSECGKGFSVKSLLNTHWRTHTGEKPYGCNECGKTFSIKFSLILH
QRTHTGEKPYECSQCQKAFTQKSHLTIHQRSHTGEKAHECSECHKAFSRKSYLLIHQRIH
SGEKPYECHECGKTFSHKFSLIIHQRIHTGEKPYGCSECGKTFPIKFSLVLHQQTHTGKK
PHECNQCQKSFAQKSHLIIHQRTHTGEKPYECTECGKAFLKRSQLSEHKRIHTGKKPHGC
SVCGKTFSKKFKLTEHQRTHKGEKTHECGDCGKAFLRKFQLTKHQKTHTGNKPHVCSICG
KAFYRKFKLTEHQRTHSGERPYECTECGKAFCRKAELIIHQRIEKGEKPHGCSECGKGFS
RKSQLILHQKIHTGEKSYICSDCGKGFIQKGNLTIHRRTHTGEKPYGCTECGKAFSQKAC
LIAHQRFHTGRTPSVCIDCGKSCSQKSGLIKHQRIHTGEKPYACSECGKAFTTRTMLIVH
QRTHTGERPYGCHECGKAFSHMSCLVKHKKIHTREKQ
Download sequence
Identical sequences ENSSSCP00000003521 ENSSSCP00000003521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]