SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003932 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003932
Domain Number 1 Region: 328-374
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.56e-17
Family TRASH domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003932   Gene: ENSSSCG00000003627   Transcript: ENSSSCT00000004023
Sequence length 1177
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:85026747:85148157:-1 gene:ENSSSCG00000003627 transcript:ENSSSCT00000004023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEREVESSPRKRFEQKAGAVFDEIVENCGGIMDTEMSEDIDHNLTPTLDSMSYGMPNQT
GSENSLLDEDDYFLNSGDLAGIPVVGSDNEDEQDFSSKDNLVSSIHTDDSLEVERRVTQH
ESDNENEIQIQNKLKKDFPKQFDQVSVFKSIRKDFSLVRENSKETFSGKEKNRDLTYHER
EKRLDKPHKELDSRLKSSFFDKAANQVEETLHTHLPQTPETNFRDSSYPFANKESIGSEL
GNSFASNIRIKEEPLDDEYDKAMAPQQGLLDKIKDEPDNAQEYSHGQQQKTQEGELKISA
VFSVSGSPLAPQLTTGFQPSLASSGMNKMLPSVPATAVRVSCSGCKKILQKGQTAYQRKG
STQLFCSTLCLTGYTVPPARPPPPPTKKTCSSCSKDILNPKDVISAQFENTTTSKDFCSQ
SCLSTYELKRKPVVTINTNSISTKCSMCQKNAVIRHEVNYQNVVHKLCSDTCFSKFRSAN
NLTMNCCENCGGYCYSGSGQCHMLQIEGQSKKFCSSACVTAYKQKSAKITPCALCKSLRS
SAEMIENTNSLGKTELFCSVNCLSAYRVKMVTSAGVQVQCNSCKTSAIPQYHLAMSDGSI
RNFCSYSCVVAFQNLFNKPTGMNSSVVPLSQGQVIVSIPTGSTVSAGGNTSAVSPTSISS
SAAAGLQRLAAQSQHVGFARSVVKLKCQHCNRLFATKPELLDYKGKMFQFCGKNCSDEYK
KINNVMAMCEYCKIEKIVKETVRFSGADKSFCSEGCKLLYKHDLAKRWGNHCKMCSYCLQ
TSPKLVQNNLGGKVEEFCCEECMSKYTVLFYQMAKCDGCKRQGKLSESLKWRGEMKHFCN
LLCILMFCNQQSVCDPPSQNNAASISMVSAASAGPPSLRKDSTPVIANVVSLASAPAAQP
TVNSNSVLQGAVPTVTAKIIGDASTQTDALKLPPSQPSRLLKNKALLCKPITQTKATSCK
PHTQNKECQTEDTPTQPQIIVVPVPVPVFIPIPLHLYTQYAPVPFGIPVPMPVPMLVPSS
MENEDKVTESIEDIKEKLPSHPFEADLLEMAEMIAEDEEKEKTLSQGGSQTSEQELFLDT
KIFEKDQGSTYSGDLESEAVSTPHSWEEELNHYALKSNTVQDTDLEVKQFSKGETEQDLE
ADFPSESFDPLNKGQGIQARSRTRRRHRDGFPQPRRR
Download sequence
Identical sequences ENSSSCP00000003932 ENSSSCP00000003932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]