SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004317 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004317
Domain Number 1 Region: 465-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.52e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 58-118
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.89e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 521-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 689-746
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.78e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 409-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 577-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 635-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 731-783
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.04e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 356-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000681
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 10 Region: 298-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000236
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000004317
Domain Number - Region: 263-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00834
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004317   Gene: ENSSSCG00000003995   Transcript: ENSSSCT00000004418
Sequence length 796
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:57292699:57314691:-1 gene:ENSSSCG00000003995 transcript:ENSSSCT00000004418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAINPWASWGILTDHSWGIAAVDPWASWALCPQDPAWRVEETPEERRRGPGLPSAQARE
LVTFKDVAVDFTQEEWGQLDPVQRTLYRDVMLETYGHLLSVGHQMAKPEVISLLEQGEEP
WSTEQPYSPPGTCPEWMRNLESKALIPTRSIFEEEQSHSVKLERYIWDDPWFSRLEVLGC
KDQLEVCRMNQSTAMRQMVFMQKQVLSQRGSEFCELGTGCSQSLNIVPSQKVSQIEHFYK
PDTNAESWRCNSAIMYADKLTCEHSEYDKAFYQSVQPVHPARGHTGDNIFKCTDAVTSFN
HILHFGDHMGMHTGEKLYEYKECHQIFNQSPSFSEHPRLHIGGNQYDYKEYENIFYFSSF
MEHQKIGTVETAYKYNEWEKVFGYDSFLTQHTSTYTAEKPYEYNECGTSFIWSSYLIQHK
KTHTGEKPYECDKCGKVFRNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHKRIHT
GEKPYVCNECGKSFNWNSHLIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEKP
FKCDECEKAFRDYSALSKHERTHSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNCQ
ECGKAFRERSALTKHEIIHSGIKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCGK
SFSQSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRRTHTGEKPYRCNECGKAFNE
SSSLIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICNDCGKAFSGHSAL
LQHRRSHSEEKLCELN
Download sequence
Identical sequences F1SC26
ENSSSCP00000004317 ENSSSCP00000004317 XP_005664991.1.46622 XP_013854349.1.46622 XP_013854351.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]