SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004561 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004561
Domain Number 1 Region: 111-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000536
Family Hairy Orange domain 0.00012
Further Details:      
 
Domain Number 2 Region: 49-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000981
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004561   Gene: ENSSSCG00000004223   Transcript: ENSSSCT00000004668
Sequence length 337
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:40989586:41000919:-1 gene:ENSSSCG00000004223 transcript:ENSSSCT00000004668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRSNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMD
FMSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHLSTCASQREAAAMTSSLAHHHHPL
HPHHWAAAFHHLPAALFQPSGLHTSESTPCRLSTASEVPPAHGSALLTATFAHADSALRM
PSTGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAVAAA
TAISPPLSVSATSSPQQTSSGTNNKPYRPWGTEVGAF
Download sequence
Identical sequences F1S2V4
ENSSSCP00000004561 ENSSSCP00000004561 NP_001230258.1.46622 9823.ENSSSCP00000004561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]