SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004698 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004698
Domain Number 1 Region: 575-625
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000389
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 612-658
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000169
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 90-120
Classification Level Classification E-value
Superfamily SET domain 0.00000837
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 132-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000783
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004698   Gene: ENSSSCG00000004354   Transcript: ENSSSCT00000004811
Sequence length 709
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:75215375:75222876:1 gene:ENSSSCG00000004354 transcript:ENSSSCT00000004811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGAARAQATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRMVRGELVDES
GGSPLEWIGLIRAARNPQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFD
IPTIATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVLSSSAGRAYLHQEHAARQG
AAPAADGLHLSPKLPAPDFAAAAPVGTLRPHSQAPPALQVFGARESIKREASSAPLVTPP
PPSKWGQSKKGKEQPDRAVDMSGAARGQGHFLGIVGSSPEGAGNLAAFLGLRSAFKPAGS
ARIAAAAHGDLYREEGGGKPGAGQALSRLLGGGRAGGRLGSGENPAAAGAGHHHHHHAHH
HHHHPKCLLAGDPQPPPPPPGLPCSGALRGFPLLPGPPEEASAFKHVERAPHTAVALPGA
RYAQLPPATGLPLERCALPALDAGGVKGYPGGECSHLPAVMPAFTVYNGELLYGSPAAAA
YYPLKLHFGGLLKYPESLSYFSGPTAAALSPAELGSLASIDREIAMHTQQLSEMAAGKGR
GRLDAGTLTPAVVAAGGAGGGAGGGSGAGKPKTGHLCLYCGKLYSRKYGLKIHMRTHTGY
KPLKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSRHPGQSL
LAKAIDGPGAEPDYPPEPGEPKSDNDSDVDVCFTDDQSDPEARGSGERD
Download sequence
Identical sequences ENSSSCP00000004698 ENSSSCP00000004698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]