SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004760 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004760
Domain Number 1 Region: 402-626
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.38e-35
Family Calponin-homology domain, CH-domain 0.00034
Further Details:      
 
Domain Number 2 Region: 99-255,393-476
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.15e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.057
Further Details:      
 
Domain Number 3 Region: 737-768
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000116
Family LIM domain 0.0013
Further Details:      
 
Domain Number 4 Region: 704-736
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000713
Family LIM domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004760   Gene: ENSSSCG00000004412   Transcript: ENSSSCT00000004875
Sequence length 1084
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:84789786:84798921:-1 gene:ENSSSCG00000004412 transcript:ENSSSCT00000004875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATCLCPSLGVPGVSMASATSTNPAHAHFESFLQAQLCQDVLSSFQGLCRALELEPGGGLP
QYHKIKAQLNYWSAKSLWAKLDKRASQPVYQQGRACTSTKCLVVGAGPCGLRAAVELAML
GARVVLVEKRTKFSRHNVLHLWPFTIHDLRALGAKKFYGRFCTGSLDHISIRQLQLVLLK
VALLLGVEIHWGVTFTGLQPPPKKGSGWRAQLQPNPPAQLANYEFDVLISAAGGKFVPEG
FTVREMRGKLAIGITANFVNRRTVEETQVPEISGVARIYNQSFFQSLLKATGIDLENIVY
YKDDTHYFVMTAKKQCLLRLGVLRQDWPETDRLLGSANVVPEALQRFARAAADFATHGKL
GKLEFAQDAHGRPDVSAFDFTSMMRAESSARVREKHGARLLLGLVGDCLVEPFWPLGTGV
ARGFLAAFDAAWMVKRWAEGTGPLEVLAERESLYQLLSQTSPENMHRNVAQYGLDPATRY
PNLNLRAVTPTQVRDLYDVEAKEPVRKISDKMDSGKPATGSVGTQEELLRWCQEQTAGYP
GVHVTDLSSSWADGLALCALVHRLRPGVLEPSELQGVGALEATSWALKMAEHELGITPVL
SAQAVVSRSDPLGLIAYLSHFHSAFKSTPHNPGPVSQGTPGTASAVLFLGKLQRTLQRTR
AQADGEDAGGKKPRLEVEADTPGTKEPYVPEPSPPVTPPSEPQEASAEDLCALCGQHLYI
LERLSVEGRFFHRSCFRCWVCEVTLWPGAYGQHPEDGHFYCLQHLPQPGHKEDSGHRGPA
SQDLPTPGENNMPSGPSPPTAPQEETGPVPSPSQPTRRLIRLSSPERQRLSSLHLTPDPE
MEPPPKPPRSCSALARQALEGSFVGWGVPVQSPQVLAAMGNEEEESPSSSEEEAEEEEDV
PLDSDVEQVLWNLVKNSGPMNNYPTWRRTLLRRAREEQMKRFCKAQTIQRRLNEIEADLR
ELEAKGTELELSLRSQSSSPEQQKALWLEQLLQLVQKKNTLWPREADLMITVQELTLEEK
QWQLDQELRTYMNREETLKTAADRQAEDQVLRKLVDVVNQRDALIRFQEERRLSELASGP
GAQG
Download sequence
Identical sequences ENSSSCP00000004760 ENSSSCP00000004760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]