SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004778 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004778
Domain Number 1 Region: 141-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000446
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 2 Region: 187-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000276
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 3 Region: 82-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000013
Family Laminin-type module 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004778   Gene: ENSSSCG00000004428   Transcript: ENSSSCT00000004893
Sequence length 249
Comment pep:novel chromosome:Sscrofa10.2:1:87822314:88044744:-1 gene:ENSSSCG00000004428 transcript:ENSSSCT00000004893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSSAWCAVLPLCLLWGAACSRAASGDDSAFPFDIEGSSAVGRLDPPETSEPRVGPGSL
PPATQKCGAGFFLAQSGECLPCDCNGNSNECLDGSGLCVHCQRNTTGEHCEKCLDGYIGD
SIRGAPRFCQPCPCPLPHVANFAESCYRKNGAVRCMCKENYAGPNCERCAPGYYGNPLLI
GSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARRAKNCAG
TVCGTAAAA
Download sequence
Identical sequences ENSSSCP00000004778 ENSSSCP00000004778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]