SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005621 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005621
Domain Number 1 Region: 443-700
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-49
Family YWTD domain 0.0000000967
Further Details:      
 
Domain Number 2 Region: 234-273
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000223
Family LDL receptor-like module 0.0005
Further Details:      
 
Domain Number 3 Region: 32-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000034
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 4 Region: 148-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000144
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 5 Region: 272-312
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000393
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 6 Region: 70-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.00059
Further Details:      
 
Domain Number 7 Region: 187-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000903
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 8 Region: 107-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.00017
Further Details:      
 
Domain Number 9 Region: 360-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000259
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 10 Region: 396-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000729
Family EGF-type module 0.0012
Further Details:      
 
Domain Number 11 Region: 318-355
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000353
Family LDL receptor-like module 0.00036
Further Details:      
 
Domain Number 12 Region: 704-750
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000049
Family EGF-type module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005621   Gene: ENSSSCG00000005229   Transcript: ENSSSCT00000005763
Sequence length 845
Comment pep:known chromosome:Sscrofa10.2:1:245001214:245032893:-1 gene:ENSSSCG00000005229 transcript:ENSSSCT00000005763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTSARWALWLLLVLCLAPRESGATGAGRKAKCEPSQFQCTNGRCITLLWKCDGDEDCAD
GSDEKNCVKKTCAESDFVCSNGQCVPNRWQCDGDPDCEDGSDESPEQCHMRTCRINEISC
GARSTQCIPVSWRCDGENDCDSGEDEENCGNITCSPDEFTCSSGRCISRNFVCNGQDDCS
DGSDELDCAPPTCGAHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCGRQPVIHTKCP
ASEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGI
RDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDISKVCNQEQDCRDWSDEPLKECHVNEC
LVNNGGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCE
CSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAA
QKLFWADLSQKAIFSASIDDKVGRHVKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVA
TLDGSKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRALVTTDIQ
WPNGITLDLIKGRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWI
DGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEEDMENGGCEYLCL
PAPQINDHSPKYTCSCPNGYRLEDSGRECQRINVTTAVSEISVPPKGTSAAWAILPLLLL
AMAAVGGYLMWRNWQHKNMKSMNFDNPVYLKTTEEDLSIDIGRHSASVGHTYPAISVVST
DDDLA
Download sequence
Identical sequences E7CXS1
ENSSSCP00000005621 NP_001186819.1.46622 XP_020939907.1.46622 ENSSSCP00000005621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]