SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005701 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005701
Domain Number 1 Region: 1434-1503
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000144
Family SH3-domain 0.0028
Further Details:      
 
Domain Number 2 Region: 996-1170
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000196
Family RUN domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005701   Gene: ENSSSCG00000005308   Transcript: ENSSSCT00000005846
Sequence length 1513
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:263990421:264048276:1 gene:ENSSSCG00000005308 transcript:ENSSSCT00000005846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLFELSRMDSPPKLTGETLIVHHIPLVHCQVPDRQCCGGASGGSGSTRPNPFCPPELGL
TQPDQDLGQADSLLYNSLHSAPGGSVRSTDSTKSRGRDGRGPGAPKRHNPFLLQEGVAEP
GLGDQYDDSIGDITTQQSFHLHGAGKPTFHLSSFQLPPPAPRVGRPWGTTRSRAGVVEGQ
EQEPVTTLNTQQCSSSHCCRPELEAETMELDECGGPGGSGSGGGASDISGFSFDQEWKLS
SDDSPRNPRFSGSGPQHCRCSSTSSQSEAADQSMGYVSDSSCNSSDGVLVTFSTLYNKMH
GNSHANLNSAPQSCSDSSFCSHSDPGAFYLDLQPSPAESKMSCESHHPDSGGREGGYGCP
HASSPELDANCNSYRPHCEPCPAVADLTACFQSQARLVVATQNYYKLVTCDLSSQSSPSP
AGSSITSCSEEHTKISPAPGPGPDPGSSQPSEYYLFQKPEAQTEEQEAVGSAMEAAAPMG
PNVIEGQVYTNTSPPNLSTGRQRSRSYDRSLERSPAVRLGSLERMLSCPVRLSEGPAALT
VPGSPPRRVTSFAELAKGRKKAAGSGSPPLRVSVGDSSQEFSPIQEAQQDRVGPLDEGTH
CSHSLPPMPLEPGMDLVGPEPWSTQVCQGPQSSEMTPAGLRAAGQGPLAQLMDPGPALPG
SPANSHTQRDARARADGGGTESRPVLRYSKEQRPTTLPIQPFVFQHHFPKQLAKARALHS
LSQLYSLSGCNRVQQPAPLAVPNAQAPALAPSEESQAPTSRGARKAGPELETSRPSPLGS
YSPIRSAGPFGPSTDSSASTSCSPPPEQAAATESPPLWSHSCPPAVRPATSQQPQKENQK
ILPLAEYRLHGTGSLPPLGSWRSSLSRAESLARGGGEGSMASRPSNANHLSPQALKWREY
RRKNPLGPPGLSGSLDRRPQEARLARRNPIFEFPGSLSAVGHLNCRLNGQVVKPLPLTCP
DFQDPFSLTEKPPAEFCLSPDGNSEAVSIDLLQKKGLVKAVNTAVDLIVAHFGTSRDPGV
KAKLGNSSVSPNVGHLVLKYLCPAVRAVLEDGLKAFVLDVIIGQRKNTPWSVVEASTQLG
PSTKVLHGLYNKVSQFPELTSHTMRFNAFILGLLNIRSLEFWFNHLYNHEDIIQTHYQPW
GFLNAAHTVCPGLFEELLLLLQPLALLPFSLDLLFQHRLLQSGQQQRQHKELLRVSQDLL
LSAHSTLQLARSRGQEGPGDMDRAAHGERVKGVGAPEGGEDEEEEEETEAAGSSGRGRWA
RSGQAGWWYQLMQSSQVYIDGSTEGSRFPRGGSNSSSGSSSEKKKGAGSGGPPPREGVVE
GAEACPAPEETLGRDRGWPFWMGSPPDSVLAELRRSREREGSAAPPAESEEGASEPSPGG
IKWGHLFGSRKAQREARPTNRLPSDWLSLDKSMFQLVAQTVGARREPEPKESLQEPHSPA
LPSKSPCEVKALCHHLATGPGQLSFRKGDILRVLGPAGGDWLRCSRGPDTGLVPLAYVTL
TPTPSPTPGSSQN
Download sequence
Identical sequences F1SG07
XP_001927847.1.46622 XP_005660276.1.46622 XP_005660277.1.46622 ENSSSCP00000005701 9823.ENSSSCP00000005701 ENSSSCP00000005701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]