SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005862 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005862
Domain Number 1 Region: 145-215
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000264
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 2 Region: 205-265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000737
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 3 Region: 92-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000196
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 4 Region: 35-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000023
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 496-592
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000044
Family Fibronectin type III 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000005862
Domain Number - Region: 9-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00879
Family EGF-type module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005862   Gene: ENSSSCG00000005465   Transcript: ENSSSCT00000006011
Sequence length 715
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:283606227:283742651:-1 gene:ENSSSCG00000005465 transcript:ENSSSCT00000006011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDSDVCASCHKHATCEQREGKKMCICKYGFVGNGRTHCIDKNECQFGATVVCGNHTSCH
NTLGGFYCICLEGYRATNNNKTFIPNDGTFCTDIDECEVSGLCRHGGRCVNTHGSFECYC
MDGHLPKSGPEPFHPTRDATLCTEIDCGTPPEVPDGHIIGNYTSRFGSQVRYACKEGFFS
DPEDTVSSCTASGTWESPKLNCQEINCGRPPEVPHAVLVGNHSSSLGGVAHYVCQEGFES
SGGKITSVCTGKGTWRASAFTCTEIIIEINDLAVFNNTCVRWQRNPRRINSELVYEIHIK
GQRLDPMESVHEETVNLTTNSRTPEVCLDLHQGTNYTVSISTTPPRRSVPAVIAFQTAED
DLLEDDGIFNISMFNEACLKLHRHSRKVGSEQVYQFKVLGQRQYLNNFYHSTSFNFTTRE
RAAVLCLDLYPATDYTVNVTLLGSPERHSVQITTTTAPAVKQTISNISVFNETCLRWRSM
KTADIEEMYLFRIRGQRWYQKAFAQEVIFNITASSQTPETCLDLSPGTNYSISIQALSSE
LPVVISLTTRITEPPLPEIDFVTVHGGPLPRLRLRKAEEINGPISSYQVLVLPLALQSTF
VCDSEEAPSFFSNASDAKGYVTAELLAKDIPNDAMEISIGDRLYYGKYYNAPLKKGNDYC
IILRITSELNKVRRSSCAVWAQVKDSSLTLQQVVGVGLGSMAAVIVLAFLSFSAV
Download sequence
Identical sequences ENSSSCP00000005862 ENSSSCP00000005862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]